


| Basic Information | |
|---|---|
| Taxon OID | 3300003437 Open in IMG/M |
| Scaffold ID | draft_100611 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the San Pedro channel, Pacific Ocean in the San Pedro Ocean Time-series (SPOT) study- Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11684 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The San Pedro Channel, Pacific Ocean In The San Pedro Ocean Time-Series (Spot) Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | San Pedro Channel, Pacific | |||||||
| Coordinates | Lat. (o) | 33.55 | Long. (o) | -118.42 | Alt. (m) | Depth (m) | 890 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063768 | Metagenome / Metatranscriptome | 129 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_1006117 | F063768 | GAGG | MDMEAVQDPLTTAEGVAEFVVLAELSRALSERLAGWSVDGAGPGSSATMASLASRLDEHSTWWTERIPESVLLEGERTAASGSGRLVEVLDLLDVPASDRNAAVVPVLDRLVAYLGALAERLSPLGDAPALRTIRLVLADLVDRPR* |
| ⦗Top⦘ |