NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25921J50272_10009587

Scaffold JGI25921J50272_10009587


Overview

Basic Information
Taxon OID3300003430 Open in IMG/M
Scaffold IDJGI25921J50272_10009587 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2890
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F002387Metagenome / Metatranscriptome565Y
F009685Metagenome / Metatranscriptome314Y
F033433Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
JGI25921J50272_100095872F002387AGGAGGMASFLEDVNQMVIDACYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDEFIYAEFNKFYELKEGDEDYLC*
JGI25921J50272_100095875F000263AGGMNNEDIGLPPHLQRMVNYDINGLDIMHGELKNLMLIWEKELEKAQAIEDETEEAMDSMERKYCEGFLDALTALYKLTYDLSFAIGIRTENRKDGHL*
JGI25921J50272_100095876F033433AGGAVNDVSLEILEVNYSISPGGVDEFEVYSVGPRSNISDLLFSSPKLEEAVRYCYDLGKDFTVRTLAEWEERELAYEARG*
JGI25921J50272_100095878F009685AGGAGGMKMSDQYVDTVLAEAQRLLWGGSETENIEAHNLISKLIKDRMSEKNLS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.