NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold rootL2_10306353

Scaffold rootL2_10306353


Overview

Basic Information
Taxon OID3300003322 Open in IMG/M
Scaffold IDrootL2_10306353 Open in IMG/M
Source Dataset NameSugarcane root Sample L2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1192
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location NameAyr, Queensland Australia
CoordinatesLat. (o)-19.733298Long. (o)147.17873Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000733Metagenome / Metatranscriptome916Y

Sequences

Protein IDFamilyRBSSequence
rootL2_103063531F000733AGGAGGMPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPEAESPLHGKVSFNSWTDAELKLDPIEAAIAGIPASVSLERASDVHLTDAGGGALQWVLHAPSTNWSLQATMWPGSLHLFVSDAEDEDEQLY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.