NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052192_1005306

Scaffold Ga0052192_1005306


Overview

Basic Information
Taxon OID3300003153 Open in IMG/M
Scaffold IDGa0052192_1005306 Open in IMG/M
Source Dataset NameMarine microbial communities from deep-sea hydrothermal vent plumes in the Guaymas Basin
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2234
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From Deep-sea Hydrothermal Vent Plumes In The Guaymas Basin

Source Dataset Sampling Location
Location NameGuaymas Basin, Gulf of mexico
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008625Metagenome / Metatranscriptome330Y
F013899Metagenome / Metatranscriptome267Y
F032036Metagenome / Metatranscriptome181N

Sequences

Protein IDFamilyRBSSequence
Ga0052192_10053065F008625GGAVVEISGNRLVWRHIQKENQKMILDPLDYDPIIDIDEIHSRNRRKTDDPYIRATMKNADHKRWKDNPAERR*
Ga0052192_10053066F032036GGAGMKWIILVYLTIAAGTTEGDIXYTRLEXPAKDFQECIXXEQQINDLIHRGRESETKYVRFLYWEYKNMLHEIKAECIYADSPVSTPKWFNEX*
Ga0052192_10053067F013899N/ALSAAINSLFPDTCAIEEGERGQFELFQSGKSFMSAGYGKFFDLEDVKKKLTESGQDLFTNR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.