Basic Information | |
---|---|
Taxon OID | 3300003148 Open in IMG/M |
Scaffold ID | Ga0052262_1093089 Open in IMG/M |
Source Dataset Name | Algal bloom microbial communities from Baltimore Inner Harbor, Chesapeake Bay |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 607 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltimore Inner Harbour, Chesapeake Bay, Maryland, USA | |||||||
Coordinates | Lat. (o) | 39.283 | Long. (o) | -76.611 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053758 | Metagenome / Metatranscriptome | 140 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0052262_10930891 | F053758 | N/A | HRLNKCPELWWDNLTAAYLDDMMASVRRNEKGGSRTKSNARFYSRTKQAPETAELPKGCSEEGIGSFIHWDGWVSHQLPIKEIKKEMELIGVDPKEGDTVVVWVGSNFIPARHRMSSLLDAINQLHAMKVKLIWDSPTFQDDALMAATTTYDAGRDPRNNQPIAYNYMKQRKKRGHIGSNEFKTEKELFDQGIEIPTTKRWQ |
⦗Top⦘ |