Basic Information | |
---|---|
Taxon OID | 3300003102 Open in IMG/M |
Scaffold ID | Ga0052256_101385 Open in IMG/M |
Source Dataset Name | Soil and Ice psychrophilic microbial communities from Leh Laddakh, India - psychrophilic sample |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | National Bureau of Agriculturally Important Microorganisms, Indian Council of Agricultural Research |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 507 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Unclassified → Soil And Ice Psychrophilic → Soil And Ice Psychrophilic Microbial Communities From Leh Laddakh, India |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | India: Khardoong La sub glacial region at Leh Laddakh | |||||||
Coordinates | Lat. (o) | 34.1453972 | Long. (o) | 77.5676139 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003192 | Metagenome / Metatranscriptome | 502 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0052256_1013851 | F003192 | AGGAG | MSTTPPSDPPPSQQPGGYDRPGGGGPNVNLNLAALMPTPGNAELVVYILATILIAIIALVADQVDSGAFVTAFTVLTFGYLLSRGIAKASRVLER* |
⦗Top⦘ |