NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052256_101385

Scaffold Ga0052256_101385


Overview

Basic Information
Taxon OID3300003102 Open in IMG/M
Scaffold IDGa0052256_101385 Open in IMG/M
Source Dataset NameSoil and Ice psychrophilic microbial communities from Leh Laddakh, India - psychrophilic sample
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNational Bureau of Agriculturally Important Microorganisms, Indian Council of Agricultural Research
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)507
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Soil And Ice Psychrophilic → Soil And Ice Psychrophilic Microbial Communities From Leh Laddakh, India

Source Dataset Sampling Location
Location NameIndia: Khardoong La sub glacial region at Leh Laddakh
CoordinatesLat. (o)34.1453972Long. (o)77.5676139Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003192Metagenome / Metatranscriptome502Y

Sequences

Protein IDFamilyRBSSequence
Ga0052256_1013851F003192AGGAGMSTTPPSDPPPSQQPGGYDRPGGGGPNVNLNLAALMPTPGNAELVVYILATILIAIIALVADQVDSGAFVTAFTVLTFGYLLSRGIAKASRVLER*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.