Basic Information | |
---|---|
Taxon OID | 3300002930 Open in IMG/M |
Scaffold ID | Water_103238 Open in IMG/M |
Source Dataset Name | Estuary water microbial communities from Pearl Estuary, Zhujiang, China |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2692 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water → Estuary Water Microbial Communities From Pearl Estuary, Zhujiang, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pearl Estuary, Zhujiang, China | |||||||
Coordinates | Lat. (o) | 22.67 | Long. (o) | 113.71 | Alt. (m) | Depth (m) | 6 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002613 | Metagenome / Metatranscriptome | 543 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Water_1032383 | F002613 | GAGG | MLKAFYFALHFAVMFLGLIIAIHIDMWIGLGIFGLFIIKFMLMLPDLNERTDI* |
⦗Top⦘ |