NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Water_101459

Scaffold Water_101459


Overview

Basic Information
Taxon OID3300002930 Open in IMG/M
Scaffold IDWater_101459 Open in IMG/M
Source Dataset NameEstuary water microbial communities from Pearl Estuary, Zhujiang, China
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4412
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (14.29%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water → Estuary Water Microbial Communities From Pearl Estuary, Zhujiang, China

Source Dataset Sampling Location
Location NamePearl Estuary, Zhujiang, China
CoordinatesLat. (o)22.67Long. (o)113.71Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002413Metagenome / Metatranscriptome561Y
F004790Metagenome / Metatranscriptome423Y

Sequences

Protein IDFamilyRBSSequence
Water_1014595F004790N/AMETLTPETLAWARKVGLSPDRVAFLLTCPKYTVSKGNRKSDRVITDNPNHHLQRLGDCYWFRLRRRGTDIVENIGHDLETARKRRDEMLLAFDSGKPVPHLNAK*
Water_1014596F002413N/AMTDEAPTLMAAPTLVLISGFARAGKDTLATGLLEWSTRAAEHINYADALKEAGNHFMDYLGLDGNFLNEDFKVENRDALVHFGKFARRLDKDVFARHFANWCPVMKHHDQVSPETVVCSDWRYINELRVCQDILWEKGWKVRTIYVSTAGVGPANDEELDSIAEIRAAHSFDQEYIFKPNARQQIMSEGRILARSWRL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.