Basic Information | |
---|---|
Taxon OID | 3300002895 Open in IMG/M |
Scaffold ID | MAL_1001472 Open in IMG/M |
Source Dataset Name | Midway enrichment cultures of iron-reducing bacteria from Chocolate Pots hot spring, Yellowstone National Park |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 587 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Iron-Reducing Enrichment Culture → Iron-Reducing Enrichment Culture Microbial Communities From Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Yellowstone National Park, Wyoming | |||||||
Coordinates | Lat. (o) | 44.71538 | Long. (o) | -110.73627 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001564 | Metagenome / Metatranscriptome | 670 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MAL_10014722 | F001564 | N/A | GGLGPKLSAGEWPEQPSLRFLVHWALRREQLCDPGLCPDAPDDGGRCGHCPLDKLDAAQSSEPGLLLRRAIDLRAALKLGVRIDLDEIRADEFRATLTVEEERERLDRERFEDRRP* |
⦗Top⦘ |