NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold contig_10052

Scaffold contig_10052


Overview

Basic Information
Taxon OID3300002843 Open in IMG/M
Scaffold IDcontig_10052 Open in IMG/M
Source Dataset NameStormwater retention pond microbial communities from Williamsburg, VA - Sample from Greensprings
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2989
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va

Source Dataset Sampling Location
Location NameJamestown, Virginia, United States
CoordinatesLat. (o)37.248966Long. (o)-76.787831Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061680Metagenome / Metatranscriptome131Y
F092029Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
contig_100522F061680N/AMQVTIGIEVAYFDYDDVHGNCEFKITNITDEDYEVEISNVLATQVIGEVELDYILTDTELDQLKEEIMWCIQDTNLVRDMQDFDNEFDEDAWRYDA*
contig_100526F092029N/AMKYTKYYRMWLEDKVEPEGGTWCYMGMDEKGFLWQLNFQYKENEQPETLEQYLRWGYKIQEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.