| Basic Information | |
|---|---|
| Taxon OID | 3300002822 Open in IMG/M |
| Scaffold ID | BMAI_1164907 Open in IMG/M |
| Source Dataset Name | Illumina_Fosmid_Bertioga |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2159 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_54_11 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil → Mangrove Soil Microbial Communities From Bertioga, Brazil, Sampling Enzymes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South America Atlantic Tropical Mangrove | |||||||
| Coordinates | Lat. (o) | -23.89694 | Long. (o) | -46.20778 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061862 | Metagenome | 131 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BMAI_11649071 | F061862 | AGG | MKGAFKMQDDETIWYENYEPIQEYLDSEFSKKTNSAEKDPKTAKFSWLEIMKKSFHIK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |