NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BMAI_1075949

Scaffold BMAI_1075949


Overview

Basic Information
Taxon OID3300002822 Open in IMG/M
Scaffold IDBMAI_1075949 Open in IMG/M
Source Dataset NameIllumina_Fosmid_Bertioga
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)698
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil → Mangrove Soil Microbial Communities From Bertioga, Brazil, Sampling Enzymes

Source Dataset Sampling Location
Location NameSouth America Atlantic Tropical Mangrove
CoordinatesLat. (o)-23.89694Long. (o)-46.20778Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089956Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
BMAI_10759491F089956GGAMVIHELDPDALAQTGEQRRPVAGKDRLHKELVLVDQSQICQRQGERHAADPQALAWLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.