NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25134J35505_10078399

Scaffold JGI25134J35505_10078399


Overview

Basic Information
Taxon OID3300002518 Open in IMG/M
Scaffold IDJGI25134J35505_10078399 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_6_100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)757
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-104.89Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024646Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
JGI25134J35505_100783993F024646AGGAGMTEHQLEKIHNYTRYKVIEVLINKHNEGNTLSDLDEVEDVAQDIVDMLGLVGAKYYAKGNR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.