Basic Information | |
---|---|
Taxon OID | 3300002392 Open in IMG/M |
Scaffold ID | JGI24503J29689_10096269 Open in IMG/M |
Source Dataset Name | Biogas fermentation microbial communities from Germany - Plant 3 RNA2 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 780 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bielefeld, North Rhine-Westphalia, Germany | |||||||
Coordinates | Lat. (o) | 52.0385 | Long. (o) | 8.4956 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075995 | Metagenome / Metatranscriptome | 118 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24503J29689_100962693 | F075995 | AGGAG | LRKYRPLRKANVHIITNDFKKVFYGMRTLYTKGLSTQKYIRYKNRYYPAYFDGYHTYHVRIKR* |
⦗Top⦘ |