Scaffold JGI24503J29689_10015680

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24503J29689_10015680

Scaffold JGI24503J29689_10015680

Overview

Basic Information
Taxon OID	3300002392 Open in IMG/M
Scaffold ID	JGI24503J29689_10015680 Open in IMG/M
Source Dataset Name	Biogas fermentation microbial communities from Germany - Plant 3 RNA2 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	649
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location Name	Bielefeld, North Rhine-Westphalia, Germany
Coordinates	Lat. (^o)	52.0385	Long. (^o)	8.4956	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092110	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24503J29689_100156801	F092110	N/A	LGYKNVDAVIDSVGVEYSYDKEYNCSVFHPLIVCYVGKHRITIDGPSVWETLVIKPCKKVQVKDLKVGDVIERDNQRGFVNYVGEKYATIHWFSKLGLKTYDDYYSKEIKDAEVVGHIDLWNL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.