Basic Information | |
---|---|
Taxon OID | 3300002220 Open in IMG/M |
Scaffold ID | MLSBCLC_10719306 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 619 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Syncrude, Ft. McMurray, Alberta | |||||||
Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.55 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011148 | Metagenome / Metatranscriptome | 294 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MLSBCLC_107193062 | F011148 | N/A | PIIAGELVYQQNTYWNLALTNEIGNPVDLTGATIDAQIVRRTLSNVQDTRYGISFDIGDYTPAPTPVSLTIANRNDALGQFTLVIDDAAWGLVASDADMSINSLNGAGYSGRIKISFPQVGVTPQDDNIIFLLFIVRSDGIVKV* |
⦗Top⦘ |