NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MLSBCLC_10152765

Scaffold MLSBCLC_10152765


Overview

Basic Information
Taxon OID3300002220 Open in IMG/M
Scaffold IDMLSBCLC_10152765 Open in IMG/M
Source Dataset NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4833
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameSyncrude, Ft. McMurray, Alberta
CoordinatesLat. (o)57.02Long. (o)-111.55Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004762Metagenome / Metatranscriptome424Y
F016643Metagenome245Y

Sequences

Protein IDFamilyRBSSequence
MLSBCLC_101527651F004762AGGMATGGEVLGMLIPTGGWVITGDEYESIQFLECNPISKAEFDAGFLTFDSWKAKQDAEQAAAKLSAEAKLEALGLTTDD
MLSBCLC_101527653F016643GGAMTLFNPVWRVRIGGINYTNYVLANLTITSGRTNIYEQAQAGYVNLQLINLDQSIVDIEINDAVSVELQDSTATFVPIFGGTVVEFDIGIAASGVVGINQSVSITALGALSRLPKSLVDGVLVKENDGDQIWSILSDLLLNTWNEVPGALQWNTYTAGETWANAQNLGLGEIDRPGEYELAKRNASRIDVYSLVSALATSGLGYIFENAQGQISYAAALHRSLYLAANGYTDVSAAQALANSLSIQTRSGDIRNEITLKYKENSTLEVTDSDPDSILAFGPLAQIITTTIENATDAADQAAFYLTLRAYPQANFNQITFELTNPEIDDVDRDSLINIFMGLPLRISDLPLNMASGTYLGFVEGWTWRAAYNTVSVTAILSPLAFSLQAMQWEDVLPAEEWNTISGSLDWATALVVA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.