Basic Information | |
---|---|
Taxon OID | 3300002166 Open in IMG/M |
Scaffold ID | JGI24713J26584_10052857 Open in IMG/M |
Source Dataset Name | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 967 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bielefeld, North Rhine-Westphalia, Germany | |||||||
Coordinates | Lat. (o) | 52.0385 | Long. (o) | 8.4956 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031138 | Metagenome / Metatranscriptome | 183 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24713J26584_100528573 | F031138 | AGAAGG | MMKKETYVGPCATACNPGAGTDAQNGTFDRILVAAAEHAAREAGLPGRADRMIACRSCGAPTTSSDGICRDCAYAMCEERAAALGERCRIHRVRYVEDLPVSALEEMQSEWGRC* |
⦗Top⦘ |