NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24766J26685_10009711

Scaffold JGI24766J26685_10009711


Overview

Basic Information
Taxon OID3300002161 Open in IMG/M
Scaffold IDJGI24766J26685_10009711 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2597
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F000852Metagenome / Metatranscriptome860Y
F000868Metagenome / Metatranscriptome853Y
F019324Metagenome / Metatranscriptome230Y

Sequences

Protein IDFamilyRBSSequence
JGI24766J26685_100097112F000868AGGCGGMLREVGEYPVLPNTSFLENENQMIIDAEYSAIGEQLVEDWVNSNLNEGQLYADYCFAQMCESNYLKGRFNQFYDLKPEDQYYIEWDEEA*
JGI24766J26685_100097113F019324GAGGMLGYVLEDLDNMIDAVAAAITTVNSDDDPWLHGSLSKTQEFLQGLWAEGYFD*
JGI24766J26685_100097115F000263AGGAGMMNAEDIGLPPHLQRMVNYDINGLDIMHGELKNLMLIWEKELEKAQAIEDESEEAMDSMERKYCEGFLDALTALYKLTYDLSFAIGASNDN*
JGI24766J26685_100097118F000852AGGAMTTKREYLKQQGITVGARGRFSGAAKVAIDEAVKKGVTFTPEAVAKKAK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.