NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C687J26620_1008677

Scaffold C687J26620_1008677


Overview

Basic Information
Taxon OID3300002097 Open in IMG/M
Scaffold IDC687J26620_1008677 Open in IMG/M
Source Dataset NameGroundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection A1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1680
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100657Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
C687J26620_10086771F100657N/AMTQITISYTTSVSTPAGWRNETVTATVEVISPKRGRVLCVQDIGGNGNSGYGSRTGAKRQAYHVGGIAMREQGKIKNLSACCIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.