


| Basic Information | |
|---|---|
| Taxon OID | 3300002079 Open in IMG/M |
| Scaffold ID | CSTR_1019028 Open in IMG/M |
| Source Dataset Name | CSTRmetagenomics |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1156 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater Treatment Plant → Wastewater Treatment Plant Microbial Communities From Luxembourg |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Belvaux, Luxembourg | |||||||
| Coordinates | Lat. (o) | 49.507864 | Long. (o) | 5.943557 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066555 | Metagenome / Metatranscriptome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CSTR_10190282 | F066555 | AGGAGG | MKGKLRKEFIERMEAVLYGDIVEEEVEDLIHDFCDEIENRLLDVCAELKRIKGLREIDAIRNAVEELVTDLW* |
| ⦗Top⦘ |