| Basic Information | |
|---|---|
| Taxon OID | 3300002040 Open in IMG/M |
| Scaffold ID | GOScombined01_104890422 Open in IMG/M |
| Source Dataset Name | GS000c - Sargasso Station 3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1924 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (28.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Moorea, Outside Cooks Bay, Polynesia Archipelagos | |||||||
| Coordinates | Lat. (o) | -17.475834 | Long. (o) | -149.81223 | Alt. (m) | Depth (m) | 1.4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000345 | Metagenome / Metatranscriptome | 1253 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOScombined01_1048904227 | F000345 | AGGAG | LELSLEKMTEKKNTWQEWWDSDACKKLQKAHQETKERAVGKYFMLSEEDKLDMIQAICYIMCKAEEEGTSHRGLQDKLGIYPTGFWISELMDVHNALWSFYHDKKREKELKDDLDTLDNFIK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |