Basic Information | |
---|---|
Taxon OID | 3300002033 Open in IMG/M |
Scaffold ID | GOS24894_10406706 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Sargasso Sea - GS000a &b |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1788 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sargasso Sea | |||||||
Coordinates | Lat. (o) | 31.175 | Long. (o) | -64.32433 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F009492 | Metagenome / Metatranscriptome | 317 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS24894_104067061 | F009492 | N/A | KFQLGITINGELSTDITFGDATTFVSPYTGLTFSGDGWVVSTNLSDGMVNIEEAKYSWNVVDGVTLTFGSQAEPYGLAWGLHRPSNNWFVSTPRDHAVTNGVGFGLNKWGVGADLFWGGDSMDENMESELYWAGRFSYGLNLLGIDSNVGLSLNSNESQLVDVSMGNDLFTTSLEYDLSEEADGAYWLRGVVTPPQAQGAFLLIGLNSDDVVTYGVGYKCSDNMKVMSEFTSRLKDADGNEVTNDFSIRASIHSNK |
⦗Top⦘ |