


| Basic Information | |
|---|---|
| Taxon OID | 3300001971 Open in IMG/M |
| Scaffold ID | GOS2215_10083514 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Sargasso Sea - GS000c |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1915 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sargasso Sea | |||||||
| Coordinates | Lat. (o) | 32.174835 | Long. (o) | -64.01017 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051981 | Metagenome / Metatranscriptome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2215_100835144 | F051981 | AGGAG | MKLKFNNLPDILDWIREPSHKEHLFLIEAAIAQAKGSKKVSFSVGDKVIFGRPNGRKHHGFIVKKNPAKAVVDCNGSKWRVPYSLMEAA* |
| ⦗Top⦘ |