| Basic Information | |
|---|---|
| Taxon OID | 3300001961 Open in IMG/M |
| Scaffold ID | GOS2240_1045595 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 970 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Dirty Rock, Cocos Island, Costa Rica | |||||||
| Coordinates | Lat. (o) | 5.552778 | Long. (o) | -87.087776 | Alt. (m) | Depth (m) | 1.1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012584 | Metagenome | 279 | Y |
| F099447 | Metagenome | 103 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2240_10455951 | F012584 | N/A | MKLKPTLPENTFILNEDSLPTSADTDPWGKVMVFRKDVGWTVIQQTDAVQFLAMKHTHWTFTPSYPHD |
| GOS2240_10455952 | F099447 | N/A | MTMLIDKVSIDLVTHHNNGLANLIIGCKMNMSLLKKNLMSYVQTEGDKKDEKLLRRLLSEKMPKKDADKIISHCFSDLIKWTYDDAVFQLTEIFSFTDQECEQLLKEYDILSATTEEVIMNPAPNFNATAPRDVKDLAENLWQARKHISDAKKLISATALTPDDYDNQEAFQEAVVQRANVNFHFISITKYIDEMSEYTKGYVPLKK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |