Basic Information | |
---|---|
Taxon OID | 3300001958 Open in IMG/M |
Scaffold ID | GOS2232_1050944 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Gulf of Mexico, USA - GS016 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1862 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico, USA | |||||||
Coordinates | Lat. (o) | 24.174723 | Long. (o) | -84.344444 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007473 | Metagenome / Metatranscriptome | 350 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2232_10509442 | F007473 | N/A | MKVIRLISISTFLFMLCLFENYLNTFISLDFGVYLFLISLLYIGTELFNQYFVIPIFLTGILYDSFFSTYYLGLYTSIFLVVVVLSNFLVSRYSRSNVIYTTTLSLCLLIYKIPIILEFDLDYWLTGYLTSIIVNSLLFISLKRALRNNV* |
⦗Top⦘ |