| Basic Information | |
|---|---|
| Taxon OID | 3300001956 Open in IMG/M |
| Scaffold ID | GOS2266_1041730 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1658 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rangirora Atoll, Polynesia Archipelagos | |||||||
| Coordinates | Lat. (o) | -15.143611 | Long. (o) | -147.435 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005193 | Metagenome / Metatranscriptome | 409 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2266_10417302 | F005193 | AGGA | MKIRNSLFENNQYFETISKIHSSDKLSVMDAYRVNRLVKKLNELNAEYTELKKGLLEKFGTTGEEEGQFIVEGDNKEPFMNEMNDLLNIEHDLETETLPWPKKLEDGFSAADLNVMEIFFNLDEFEPKEEEPSQQEE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |