NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2218_1019074

Scaffold GOS2218_1019074


Overview

Basic Information
Taxon OID3300001947 Open in IMG/M
Scaffold IDGOS2218_1019074 Open in IMG/M
Source Dataset NameMarine microbial communities from the Gulf of Maine, Canada - GS002
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1522
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameGulf of Maine, Canada
CoordinatesLat. (o)42.503056Long. (o)-67.24Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002182Metagenome / Metatranscriptome586Y
F002412Metagenome / Metatranscriptome561Y
F003169Metagenome / Metatranscriptome504Y

Sequences

Protein IDFamilyRBSSequence
GOS2218_10190741F002182AGGAMIYTDQENEWLSKPKKTKRVSNQTADGSAPKTQDYRKHDWAITTTIEVNGKTYIVPVQV*
GOS2218_10190742F002412N/AMLVRTIALYLIMTVCAFSFHEHTYAVFDLKEQLQMLYMNMWELLLQLEYVTSDQRVIVYQEIQHIQSDIQRVIAQLVEHDRSQHP*
GOS2218_10190743F003169N/AMHSGLRRSLYPGLTIVPLDRIITYMQYYYVLAYKGSDCHRHYVQLDQTSADILHDVLLCSYDFVQVCAVPHGVVEPDLLL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.