| Basic Information | |
|---|---|
| Taxon OID | 3300001941 Open in IMG/M |
| Scaffold ID | GOS2219_1031560 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Browns Bank, Gulf of Maine - GS003 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 861 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Browns Bank, Gulf of Maine, Canada | |||||||
| Coordinates | Lat. (o) | 42.85278 | Long. (o) | -66.217224 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091869 | Metagenome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2219_10315602 | F091869 | N/A | VIPGRNTHTRHTHQVMTDKSSTITEGSETGSRVRYPKDSIVFPTQRNEEQIAVLLRKIEPDERALSLVLDSWTKTVAAEPPWNYSCTPHTPPTPPTLLIYEHDTLLKKIIPHSTITLACDPDDPDTVWGYVCFDGDLLHFIYVKSAFRGFGIGGCLLRSAGLPDSNLTTSHRTKSLFVAF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |