| Basic Information | |
|---|---|
| Taxon OID | 3300001936 Open in IMG/M |
| Scaffold ID | GOS2220_1000964 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Halifax, Nova Scotia, Canada - GS004 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2882 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (30.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Halifax, Nova Scotia, Canada | |||||||
| Coordinates | Lat. (o) | 44.137222 | Long. (o) | -63.644444 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020110 | Metagenome | 226 | N |
| F023484 | Metagenome | 210 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2220_10009642 | F020110 | N/A | MSTQLEVQARLSYTRAMLERGIRTASVATMVSAKFCVSRSTAYNDITAAQAEIELSDDGPSLEESSEPINTDSVLAMLQHRLEVSVATGDDKAVCSLIKAMNQAKQWNGYNTQSVSPFA* |
| GOS2220_10009643 | F023484 | N/A | MGTTPNPYHPLLNAPMNINTKTGELLIATLGRYTSKTEKIIFFKTRAGSLVSSYYISTFNSIKEGDGLMLSNSCDPDQVIDADQVAKCKTFIRNHS* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |