Basic Information | |
---|---|
Taxon OID | 3300001850 Open in IMG/M |
Scaffold ID | RCM37_1015426 Open in IMG/M |
Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1488 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ábidos, Para, Brazil | |||||||
Coordinates | Lat. (o) | -1.919017 | Long. (o) | -55.525717 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052599 | Metagenome / Metatranscriptome | 142 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
RCM37_10154263 | F052599 | AGGA | MKYWTIVFPGEHGQHVQETWNEDQIIASYFKYWCANMIQSGHGDQVTRERCIDDWCVVHWAVQTDQWGNSLVGPKTEE* |
⦗Top⦘ |