Basic Information | |
---|---|
Taxon OID | 3300001847 Open in IMG/M |
Scaffold ID | RCM41_1113950 Open in IMG/M |
Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1517 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Santar?m, Para, Brazil | |||||||
Coordinates | Lat. (o) | -2.484383 | Long. (o) | -55.0075 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078714 | Metagenome / Metatranscriptome | 116 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
RCM41_11139502 | F078714 | N/A | MKNKILSFKIEQPKHRAHRVLFVENTPFKPKVVQNKTLYKRNQKHKGNRNEY* |
⦗Top⦘ |