| Basic Information | |
|---|---|
| Taxon OID | 3300001826 Open in IMG/M |
| Scaffold ID | ACM20_104287 Open in IMG/M |
| Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM20, ROCA_DNA104_0.2um_23b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1228 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Amazon River plume to Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 10.6822 | Long. (o) | -54.4213 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001942 | Metagenome / Metatranscriptome | 613 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ACM20_1042871 | F001942 | N/A | MARKSSEEHQANSRLGALGESLVQTFLLEFCDFVYPTQDKHPADILAEVSNCKYTVQVKARRETKEGKYVFATETSRSMSDVYKNYHCDILAFVFVNQEHKRILFKPNTSSQTYYTFDKKIIKPDMEIKSLQETLDALSQVPVLNPVIK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |