NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ACM20_100439

Scaffold ACM20_100439


Overview

Basic Information
Taxon OID3300001826 Open in IMG/M
Scaffold IDACM20_100439 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM20, ROCA_DNA104_0.2um_23b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6761
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameAmazon River plume to Atlantic Ocean
CoordinatesLat. (o)10.6822Long. (o)-54.4213Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001582Metagenome / Metatranscriptome668Y
F004956Metagenome / Metatranscriptome417Y

Sequences

Protein IDFamilyRBSSequence
ACM20_1004396F001582N/AMPLESALDFNSYVDTTTGHGVTATFFEVQSALWDARNGLIDTWYDIDSGDAYSVNIIIDQEYFSIEGGTVPVDGFQPRAIMKSSDAPYISQGDKLLVNAITTNKGNTLVPATTFVIQTVEPDNTGLVSLVLEEE*
ACM20_1004399F004956AGGAGMKMISPDGKVSIKAHPSKIESLLNKGWKEEAVHSQDKVKSSSKKKSKDEVKENGNT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.