Basic Information | |
---|---|
Taxon OID | 3300001788 Open in IMG/M |
Scaffold ID | BP130528DKS3_1676739 Open in IMG/M |
Source Dataset Name | BioPara_130528DK_S3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 513 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Grass → Composting → Bioreactor → Biogas Reactor → Biogas Reactor Microbial Communities From The Max Planck Institute, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067884 | Metagenome / Metatranscriptome | 125 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BP130528DKS3_16767392 | F067884 | N/A | EWFSALARQAQKFVLYDEDQVSMLREITDTVRVYDISMEYVLGTVDRIPESRVEYACVGFSETDWVH* |
⦗Top⦘ |