NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CSTRM28_102857

Scaffold CSTRM28_102857


Overview

Basic Information
Taxon OID3300001754 Open in IMG/M
Scaffold IDCSTRM28_102857 Open in IMG/M
Source Dataset NameWastewater microbial communities from Belvaux, Luxembourg - M28
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2042
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location NameBelvaux, Luxembourg
CoordinatesLat. (o)49.506095Long. (o)5.943536Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055749Metagenome / Metatranscriptome138N
F095523Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
CSTRM28_1028571F095523GGAGGMGVSIPIEYLYITVGLLVVAVIYIINDKNNARLYNPEGPLFVKARKKEIPILRVIDPGTNHARHILGDKERDDDPVYAKDMWGLHADPAYIEGDASPERHPGGLLIYNISPNVTFPISPRNVLAQHTILRHRRDLPEFADLDFLSDRDLLVLLSSPSDHLPHDAQIFTDNYKPTIVEIDESGQPVEVEMNAADLVDRITAFRKYATTLPVEGGGFAYHEYFRNNPYGHSSQTTQRINYLFQRIADRKSAMADKLW
CSTRM28_1028573F055749N/AMNLIIAIAIGILTLIAIFSVIPVVGGSIDNAMPALGADSDWNTTTNPDLPSGASMWSQLGPLLVLAVLALVIGLVIMYFRNAAG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.