Basic Information | |
---|---|
Taxon OID | 3300001751 Open in IMG/M |
Scaffold ID | JGI2172J19969_10177220 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 589 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | White Oak River estuary, North Carolina, USA | |||||||
Coordinates | Lat. (o) | 34.640199 | Long. (o) | -77.109447 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094911 | Metagenome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI2172J19969_101772202 | F094911 | N/A | MPEFFEKSPLSGAEKQPDFQVTSCHHFVTTNVDFAYIEFE* |
⦗Top⦘ |