| Basic Information | |
|---|---|
| Taxon OID | 3300001681 Open in IMG/M |
| Scaffold ID | Abe_10065862 Open in IMG/M |
| Source Dataset Name | Black smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1995 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Abe, ELSC, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -20.111307 | Long. (o) | -176.989014 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007121 | Metagenome / Metatranscriptome | 357 | Y |
| F011446 | Metagenome / Metatranscriptome | 291 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Abe_100658622 | F007121 | N/A | MLKTILLTILLLFGFTTPASGDWQVVLQDKLQEPTLDKLIDWVPEEVPRTVSFYFDTDGDGKFDIKIAYSLIEAYACKQNCVRGIIDNGDHWILPAPGVNYYVIKRWILYRYVNDEDWRGLDKTQQWIYKYPYNDDWLREKFYPLWPEQLK* |
| Abe_100658624 | F011446 | AGGAG | MESMVFEWASTQSWWGIATTIIVVANGITMTLRDRYAEGIPILGKIWPILNWLSLNIANNKNDEK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |