Basic Information | |
---|---|
Taxon OID | 3300001680 Open in IMG/M |
Scaffold ID | KiloMoana_10034291 Open in IMG/M |
Source Dataset Name | Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2260 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Kilo Moana, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kilo Moana, Lau Basin, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.054108 | Long. (o) | -176.133522 | Alt. (m) | Depth (m) | 2600 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000713 | Metagenome / Metatranscriptome | 925 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
KiloMoana_100342914 | F000713 | AGG | MPLVKKNISVAAGATSDQILVGTPYEYVGPNTRLVVAAAESTGTYSGKVTMDFKVNNTEFSSDVAVSAKVTGEAFGWNNTGYVLNDMITTGAERNRPVITFTNNDASSVDVEVAIFIGG* |
⦗Top⦘ |