NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12053J15887_10088486

Scaffold JGI12053J15887_10088486


Overview

Basic Information
Taxon OID3300001661 Open in IMG/M
Scaffold IDJGI12053J15887_10088486 Open in IMG/M
Source Dataset NameMediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1693
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameEl Dorado National Forest, Georgetown, California, USA
CoordinatesLat. (o)38.88Long. (o)-120.64Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002385Metagenome / Metatranscriptome565Y

Sequences

Protein IDFamilyRBSSequence
JGI12053J15887_100884862F002385N/ALSNQAHELHQTLQKVMRSFGRQCRGQGKVFVTLVRQTERHLLALGEAIATWTQETQTLLHHTTALCEPQRQRLLRALEAASAAHRQIVKQSQRLTQGKGLQHCKIVNAYDPTIAPILKGKSNCPAQFGRKTGILSEPASGFIFANRVPEGNPSDPSYVLPLLDKVQRAIDLVPSPHRVRVHSLGGDLGINDAELRHALHGRGILTVGIPTTVAPINPTPSQQEVQDILKASSLQRIRTPHQVHLACASGYSRPVVESHIATLMSRGAGHVRYKGLEGAIIQMGMTVMAHNGAVLVRIRQQHLSKRGQKFRRLLGLRRRNINEINGSKT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.