NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Abe_1086044

Scaffold Abe_1086044


Overview

Basic Information
Taxon OID3300001524 Open in IMG/M
Scaffold IDAbe_1086044 Open in IMG/M
Source Dataset NameAbe Hydrothermal Plume
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1040
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean (2)

Source Dataset Sampling Location
Location NameAbe
CoordinatesLat. (o)-21.0Long. (o)176.0Alt. (m)Depth (m)2100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020019Metagenome226Y

Sequences

Protein IDFamilyRBSSequence
Abe_10860442F020019N/ATGGSWLNIVAGFFNIKFPDTLPEWLTKLFTVGWNGIAFWQIIQITAILLVIVEYMQYDRMLKEKDQKPNATSQAVFLIIALALSLMVFPQTIQKIREMRILSNAPRTDVTKGFGGEPL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.