Basic Information | |
---|---|
Taxon OID | 3300001516 Open in IMG/M |
Scaffold ID | TahiMoana_1042907 Open in IMG/M |
Source Dataset Name | Hydrothermal vent plume microbial communities from Tahi Moana, Pacific Ocean, of black smokers |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 522 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina → unclassified Nitrospina → Nitrospina sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tahi Moana, Pacific Ocean, Of Black Smokers |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tahi Moana, ELSC, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.064428 | Long. (o) | -176.171974 | Alt. (m) | Depth (m) | 2230 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105323 | Metagenome / Metatranscriptome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TahiMoana_10429072 | F105323 | GAG | MNLKSKSTLFHTIIERVDQQLAGIPLNDSEGAPLEDSTDLDMHIDAIKEMKITNAKGDVIHPFSTAVATQLVYDELTERREQSNE* |
⦗Top⦘ |