| Basic Information | |
|---|---|
| Taxon OID | 3300001405 Open in IMG/M |
| Scaffold ID | JGI20186J14852_1000014 Open in IMG/M |
| Source Dataset Name | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10644 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (64.29%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Barrow Environmental Observatory site, Barrow, Alaska | |||||||
| Coordinates | Lat. (o) | 71.2999 | Long. (o) | -156.61 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004821 | Metagenome / Metatranscriptome | 422 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI20186J14852_10000148 | F004821 | AGG | MSKRIQNTTFVSRGRITGLVRDESPAGTGQNRTSRSANRDSVPSAADEALFYRARLILGDALPRPNR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |