NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20151J14362_10003619

Scaffold JGI20151J14362_10003619


Overview

Basic Information
Taxon OID3300001346 Open in IMG/M
Scaffold IDJGI20151J14362_10003619 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_01
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10522
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (48.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000413Metagenome / Metatranscriptome1169Y
F004488Metagenome / Metatranscriptome436Y
F087882Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
JGI20151J14362_1000361917F000413N/ALKQFKENIPPALAETMLLDESKLVKYLWKHKALEFRYPKHKGRLDLYADEKYLMMGKLKYPTMFGNRKRMGFMELYIVHRINQRLTNAKGSI*
JGI20151J14362_1000361925F087882AGGAGMKMTKKKIALGVAIIVAAWAMWSVLKPAPAEAAEITMNGSVNYRIGNDENASGKEILKAEDNG
JGI20151J14362_100036198F004488GGAGGMFARLRGWFETWKKNLFDAYDPPKPTIYKLGQKKFVKVKRIRTGSNSKGPYLK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.