NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGIcombinedJ13537_10131981

Scaffold JGIcombinedJ13537_10131981


Overview

Basic Information
Taxon OID3300001097 Open in IMG/M
Scaffold IDJGIcombinedJ13537_10131981 Open in IMG/M
Source Dataset NameSaline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)517
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica

Source Dataset Sampling Location
Location NameLake Vida, Antarctica
CoordinatesLat. (o)-77.38861Long. (o)161.931111Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009786Metagenome313Y

Sequences

Protein IDFamilyRBSSequence
JGIcombinedJ13537_101319812F009786AGGMKLTFSELSKVLEAERIDISYRKQLAPAPFQVVTKTLKVIPERFKKIYFHAGRYSAGDRDSLAVEAWAAYEQEEDL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.