NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12218J13221_1008099

Scaffold JGI12218J13221_1008099


Overview

Basic Information
Taxon OID3300001091 Open in IMG/M
Scaffold IDJGI12218J13221_1008099 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP0203
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)910
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth of Cape Verde, Atlantic Ocean
CoordinatesLat. (o)7.33Long. (o)-26.0Alt. (m)Depth (m)4002.51
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006552Metagenome370Y

Sequences

Protein IDFamilyRBSSequence
JGI12218J13221_10080993F006552N/AINQYPTVWEATPKVEIPLLISPVLKIKSSRINPVANIPKPIPIAKKAIDILNNVGLPVFLNPIYEIVPITRPTKSPTKFRIISRKNSNYADSATVLNKVSEQVF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.