


| Basic Information | |
|---|---|
| Taxon OID | 3300000930 Open in IMG/M |
| Scaffold ID | BpDRAFT_10031356 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1109 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River plume, coastal ocean | |||||||
| Coordinates | Lat. (o) | 46.233 | Long. (o) | -124.16 | Alt. (m) | Depth (m) | 16 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033224 | Metagenome / Metatranscriptome | 178 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BpDRAFT_100313563 | F033224 | AGTAG | MSNEEVAETIHNLMALLTKIEDKQLKSDLEDQIISLCDQLKFTMIMDKLKNEKR* |
| ⦗Top⦘ |