Basic Information | |
---|---|
Taxon OID | 3300000793 Open in IMG/M |
Scaffold ID | AF_2010_repII_A001DRAFT_10054465 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 888 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil | |||||||
Coordinates | Lat. (o) | -10.171667 | Long. (o) | -62.7875 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001000 | Metagenome / Metatranscriptome | 809 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
AF_2010_repII_A001DRAFT_100544651 | F001000 | N/A | TLLREAAVRLFACLTMCLIPVLAIAAQTDDQAPSDPQAYCVDRSADFYPYTGEPCKSGYQLGSGNCRKPDGRMVAVPREQCDAMAGTVELPFEGGRPLDGPQAPKSTK* |
⦗Top⦘ |