NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BS_KBA_SWE02_21mDRAFT_10176121

Scaffold BS_KBA_SWE02_21mDRAFT_10176121


Overview

Basic Information
Taxon OID3300000792 Open in IMG/M
Scaffold IDBS_KBA_SWE02_21mDRAFT_10176121 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameKBA site, Vaertahamnen, Baltic Sea, Sweden
CoordinatesLat. (o)59.363333Long. (o)18.119167Alt. (m)Depth (m)21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045540Metagenome152Y

Sequences

Protein IDFamilyRBSSequence
BS_KBA_SWE02_21mDRAFT_101761211F045540N/AGSKMLRYIFTLATLLDSKSRVKKHYSPDTVISDLFNKDLNEIDFINSLSELELIFGFEIPEDFYEKTNLTLEQFAEELSQLPLISIELYEEFFDIKFTSMKLTKRYIELENKTDAESVRELDEINKHFELLTDRLNVLLGNTLVN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.