Basic Information | |
---|---|
Taxon OID | 3300000730 Open in IMG/M |
Scaffold ID | fpDRAFT_1004657 Open in IMG/M |
Source Dataset Name | Illumina Fosmids (spades contigs) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Illumina |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9395 |
Total Scaffold Genes | 21 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (19.05%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Activated Sludge → Activated Sludge Microbial Communities From San Jose - Santa Clara Water Pollution Control Plant, Ca |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | San Jose/Santa Clara Water Pollution Control Plant | |||||||
Coordinates | Lat. (o) | 37.434249 | Long. (o) | -121.946397 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002371 | Metagenome / Metatranscriptome | 566 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
fpDRAFT_100465717 | F002371 | N/A | MKLQRNKKEKRGGTRQGSGAKPKYKEETKTVAFRCPLSKVDELKLVVKSKLSEWLVK* |
⦗Top⦘ |